EVA results for 1g25:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,
seq	MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFED
dssp	-----------HHHH-----EEE------EEHHHHHHHHH------------------EEE----
jpred	-------------------EEEE-------HHHHHHHHH--------------------------	+8.8	+4.6	+0.08
phd	------------------EEEEEE-----EEHHHHEEEEEE------------------EEEEE-	+2.4	+6.1	+0.05
phdpsi	------------------EEEEE-----HHHHHHHHHHH-------------------EEEEEE-	+6.0	+7.5	+0.12
prof_king	--------------------EEE------HHHHHHHHHHH-------------------------	+11.8	+4.0	+0.18
profsec	-------------------EEEE-----HHHHHHHHHHH-------------------EEEEE--	+6.7	+8.0	+0.11
psipred	------------------EEEEEE----HHHHHHHHHHH--------------------------	+2.3	+0.5	-0.06
pssp	---------EEEE------EEEEEEEE-----HHEEEEEE-----------------EEEEEE--	+1.6	+12.5	+0.03
samt99_sec	---------------------EEE----EE-HHHHHHHHH-------------------------	+7.2	+2.6	+0.11
sspro1	-------------------EEEE-----HHHHHHHHHHHH--------------HHHHHHHHH--	-2.1	+6.2	-0.03

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)