EVA results for 1fse:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,..
seq	SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL
dssp	------HHHHHHHHHH-----HHHHHHHH---HHHHHHHHHHHHHHH----HHHHHHHHHH------
jpred	------HHHHHHHHHHH----HHHHHHHH---HHHHHHHHHHHHHHH----HHHHHHHHHH------	+24.3	+31.2	+0.56
phd	------HHHHHHHHHHH----HHHHHHHH---HHHHHHHHHHHHHH-----HHHHHHHHHHH-----	+24.1	+33.0	+0.47
phdpsi	-----HHHHHHHHHHHHH---HHHHHHHH---HHHHHHHHHHHHHHH----HHHHHHHHHHH--E--	+18.5	+21.9	+0.38
prof_king	------HHHHHHHHHHH----HHHHHHHHH--HHHHHHHHHHHHHH-----HHHHHHHHHHH-----	+19.6	+30.9	+0.33
profsec	------HHHHHHHHHHH----HHHHHHHH---HHHHHHHHHHHHHH-----HHHHHHHHHHH-----	+19.1	+27.7	+0.37
psipred	------HHHHHHHHHHH----HHHHHHHH---HHHHHHHHHHHHHHH----HHHHHHHHHH------	+22.3	+28.3	+0.53
pssp	------HHHHHHHEEE-----HHHHHHHH---HH-HHHHHHHHHHHH-----HHHHHHHHH------	+29.5	+28.0	+0.57
samt99_sec	------HHHHHHHHHHHH---HHHHHHHH---HHHHHHHHHHHHHHH----HHHHHHHHHHH-----	+19.6	+27.9	+0.43
sspro1	------HHHHHHHHHHH----HHHHHHHH---HHHHHHHHHHHHHHH----HHHHHHHHHH------	+22.5	+29.6	+0.54

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)