EVA results for 1fqj:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,...
seq	FGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
dssp	------------HHHH---HHHHH----HHHHHH----
jpred	--------------EEEEE------HHHHHHHHH----	-13.7	-8.5	-0.26
phd	----------------EEHHHHH----EHHHEHHH---	-0.2	+4.8	-0.04
phdpsi	--------------EEE---HHHH-HHHHHHHH-E---	-2.8	+9.4	-0.10
profsec	--------------EEEE--HHHHHHHHHHHHHHH---	-7.9	-11.7	-0.18
psipred	--------------EEEEE-HHH-----HHHHHH----	+0.1	+7.2	+0.02
pssp	-------------EEEEEE--HHHH----HHHHHHH--	+2.8	+19.4	-0.01
samt99_sec	--------------EEEE--HHHHHHHHHHHHHHH---	-7.4	-10.0	-0.16
sspro1	--------------EEEE-HHHHHHHHHHHHHHHH---	-4.8	-10.9	-0.13

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)