EVA results for 1fm0:E

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....
seq	AETKIVVGPQPFSVGEEYPWLAERDEDGAVVTFTGKVRV
dssp	--EEEEEE-----HHHHHHHH-------EEEEEEEE---
jpred	---EEEE------HHHHHHHH-------EEEEEEEEEEE	+13	+23.5	+0.33
phd	--EEEE-------HHHHHHHHH------EEEEEEEEEEE	+13.2	+25.3	+0.34
phdpsi	---EEEE------HHHHHHHHH-------EEEEEEEEEE	+8.1	+23.8	+0.26
prof_king	--EEEEE-------HHHHHH--------EEEEEEEEEEE	+10.2	+23.2	+0.25
pssp	-EEEEEE---------------------EEEEEEE-EEE	+1.1	-6.0	+0.18
samt99_sec	---EEE-------HHHHHHHHHH------EEEEEEEEEEEEEEEEH-HHHHHHHHHHHHHHHHHH----EEEEEEE---------EEEEEEE---HHHHHHHHHHHHHHHHHH--HHHEEE-----EEE----HHHHHH---	+4.4	+12.4	+0.18
sspro1	--EEEEE--------HHEHEE-------EEEEEEEEEEE	+0.9	-3.5	+0.05

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)