EVA results for 1fka:R

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5
seq	RNVEVLKRFLSETGKILPRRRTGLSGKEQRILAKTIKRARILGLLPFTEK
dssp	-----------------------------HHHHHHHHHHH----------
jpred	---HHHHHHH-----E--------HHHHHHHHHHHHHHHHHHH-------	-6.5	-29.8	-0.05
phd	--HHHHHHHHHH----E--------HHHHHHHHHHHHHHHHHHHEE----	-13.8	-34.3	-0.04
phdpsi	--HHHHHHHHHH----EE-------HHHHHHHHHHHHHHHHHHH------	-14.5	-35.3	-0.06
prof1	--HHHHHHHHH----EE--------HHHHHHHHHHHHHHHHH--------	-10.9	-34.8	-0.10
prof_king	--HHHHHHHHHH-------------HHHHHHHHHHHHHHHHHH-------	-8.3	-15.4	-0.07
psipred	--HHHHHHH-----EEEE-------HHHHHHHHHHHHHHHHHH-------	-12.6	-35.2	-0.09
pssp	--HHH-HHHHHHH--HH----------HHHHHHHHHH--EEE--------	-1.6	-26.6	-0.07
sspro	--HHHHHHHHH----E---------HHHHHHHHHHHHHHHHHHH------	-12.2	-33.7	-0.10

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)