EVA results for 1fjn:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....
seq	GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRCG
dssp	------HHHHHHHHHH-----EEEE-------EEEE---
jpred	------------------------------EEEEEE---	-15.2	-38.7	-0.13
phd	------------------------------EEEEEEEE-	-17.5	-44.5	-0.09
phdpsi	------------------------------EEEEEEEE-	-20.1	-46.0	-0.13
prof_king	--------------------------------EEEE---	-10.2	-38.3	+0.04
profsec	--------HHHHHH--------------EEEEEEEEE--	-9.6	-6.8	-0.02
psipred	--------HHHHHHH-------------EE--EEEEE--	-1.7	-3.9	+0.04
pssp	-------EEEEEEEEE-------EEEEEEEEEEEEE---	-11.6	-13.9	0.00
samt99_sec	--------HHHHHHH--------E----EEEEEEEE---	-1.4	+10.8	+0.08
sspro1	---------------------------------------	-22.1	-59.1	-0.35

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)