EVA results for 1fjg:N

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6
seq	ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
dssp	---------------HHH-------------EE----EEHHHHHHHHHH-----EEE---
jpred	-HHHHHHHHH-------E----EEE-------------HHHHHHHHHHH-----------	-11.2	-25.7	-0.17
phd	---HHHHHH----------------------HHH-----HHHHHHHHHH-----------	-0.1	-16.4	-0.08
phdpsi	--HHHHHHH--------EE----E---------------HHHHHHHHH------------	-7.8	-22.8	-0.09
prof1	--HHHHHHHH---------------------EEEE----HHHHHHHHHH-----------	-6.9	-22.4	-0.14
prof_king	-HHHHHHHHH----------------------------HHHHHHHHHHH-----------	-6.0	-29.8	-0.17
psipred	--HHHHHHH------HHHH-EEE-------EE-------HHHHHHHHHH-----------	-6.6	-20.8	-0.01
pssp	-HHH-HHHHH-----EEEEEHHHHEE-----------HHHHHHHHHH---------EE--	-10.3	-17.5	-0.09
samt99_sec	HHHHHHHHHH-----HHHHHHHHHH------HHHHH-HHHHHHHHHHHH-----------	-21.4	-17.5	-0.18
sspro	-HHHHHHHH-------EEEEEEEE------HHHHH--HHHHHHHHHHH-------EE---	-19.5	-14.4	-0.24

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)