EVA results for 1fd3:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4.
seq	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
dssp	--E-HHHHHH---EEE--------EEEEE------EEEE--
jpred	------EEE----EEEE--------E---------------	-13.2	-19.5	-0.18
phd	------EE-----EEEE--------EEEEE-----EEEE--	+4.2	+10.0	+0.08
phdpsi	------EE-----EEEE--------EEEEE-----EEEE--	+1.6	+8.5	+0.04
prof_king	----EEEEEE---EEEEE------EEEEEE----EEEE---	-3.6	+9.3	+0.04
profsec	------EE-----EEE---------EEEE-------EE---	-0.7	+2.3	+0.05
psipred	-----EEEE----EE---------EEEEE------------	-5.4	-9.6	0.00
pssp	----EEEEE----EEEEEE---HHEEEE--------EE---	+0.4	+7.8	+0.06
samt99_sec	-------------EEEEE------EEE---------EE---	-7.5	-5.0	-0.07
sspro1	-----EEE-----EEE--------EEE--------------	-7.6	-14.0	-0.05

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)