EVA results for 1f6u:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,
seq	MQKGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQAN
dssp	--HHHHHHHHH--E------E---HHH-------EE----EE---HHH-------
jpred	-----------EEEEE---------------------------------------	-17.8	-56.7	-0.26
phd	-------------EE----------------------------------------	-9.5	-53.6	-0.15
phdpsi	-------------EEE---------------------------------------	-13.9	-55.5	-0.21
prof_king	-----------EEEEE----------------------------------H----	-19.8	-49.5	-0.25
pssp	----------EEEEEE--------------------EE-------HHHHH-HHHH	-15.6	-32.4	-0.13
samt99_sec	-------------EEEE--------------------------------------	-17.6	-57.8	-0.26
sspro1	----------EEEEE-------HHH-------------------------HHH--	-25.0	-43.1	-0.31

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)