EVA results for 1f62:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5.
seq	ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT
dssp	---------------EE------EE-HHHH---------------------
jpred	-----E--------EEEE------E--------------------------	+10.1	+4.7	-0.09
phd	---EEE-------EEEEE------EEEEE--------------E-------	+3.1	-8.3	-0.08
phdpsi	--EEE--------EEEEE---------------------------------	+2.5	-11.8	-0.20
prof_king	-EEEEE-------EEEEE------EEEEE------------EEEEE-----	-11.6	-20.6	-0.24
profsec	--EEE---------EEE------HHHHHH----------------------	+7.9	+0.2	+0.06
psipred	---HH---------EEEE-----HHH-------------------------	+2.2	-2.7	-0.07
pssp	--EEEEE------EEEE--HHHHHH-EE-EE--EEE---------------	-4.1	-9.6	0.00
samt99_sec	-E-EE--------EEEE------------------------EE--------	-1.3	-28.6	-0.25
sspro1	--EEEE--------EEEE--------HHH------------EE--------	+2.4	-8.0	-0.02

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)