EVA results for 1f45:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	QNLLRAVSNMLQKARQTLEFYPCSTVEACLPLELTKNESCTS
dssp	-HHHHHHHHHHHHHHHHHHH----HHHH--EHHHHH------
apssp	---EEHHHHHHHHHHHHE-----HHEHHH--HHHE--EHH--	-5.5	+8.5	-0.09
jpred	-HHHHHHHHHHHHHHHHHH------HHH------------EE	+2.0	+5.8	+0.09
phd	-HHHHHHHHHHHHHHHHHHH-----EEEEE----------EE	-4.3	-1.4	+0.06
phdpsi	-HHHHHHHHHHHHHHHHHHH-----EEEEE----------EE	-7.2	-3.6	+0.02
prof_king	-HHHHHHHHHHHHHHHHHH-----HHHHH--HH-------EE	+6.5	+18.8	+0.10
psipred	--HHHHHHHHHHHHHHHHHH----HHHHH--HHH-----HHH	+4.7	+14.8	-0.07
pssp	--HHHHHHHHHHHHHH-EE-----HHHH-----------EEE	+3.8	+15.5	+0.13
samt99_sec	HHHHHHHHHHHHHHHHHHHH-----HEE---HHH---HHH	-0.8	+7.1	-0.09
sspro2	--HHHHHHHHHHHHHHHH-------EEE---HHH-------E	-3.3	+11.9	0

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)