EVA results for 1f43:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6.
seq	KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
dssp	--------------HHHHHHHHHHHH-----HHHHHHHHHHH-----HHHHHHHH------
jpred	------------HHHHHHHHHHHHHHHH----HHHHHHHHHH---HHHHHHHHHHHH----	+11	+28.2	+0.12
phd	-------------HHHHHHHHHHHHH-----HHHHHHHHHHH---HHHHHHHHHH------	+23.7	+31.4	+0.51
phdpsi	-------------HHHHHHHHHHHHHH-----HHHHHHHHHH------EEEEE--E----	+6.0	+18.2	+0.13
profsec	-------------HHHHHHHHHHHHH-----HHHHHHHHHH----HHHHHHHHHH------	+17.0	+26.3	+0.31
psipred	-------------HHHHHHHHHHHHH-----HHHHHHHHHHH---HHHEEEEEE-------	+7.4	+16.2	+0.22
pssp	--------------HHHHHHHHHHHH--------HHHHHH--------EEEHHHHHHHH--	+15.7	+28.0	+0.16
sspro1	-------------HHHHHHHHHHHHHH----HHHHHHHHHHH---HHHHHHHHHHHHH---	+12.5	+23.7	+0.23

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)