EVA results for 1f3u:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6..
seq	GPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMRKLR
dssp	-----EEEEEEEE------EEEEEEEE-HHH---HHH---EEEEE--HHHH--EEEE----H
jpred	-------EEEEEEE-------EEEEEE--------------HHH------HHHHHHHHHHHH	-21	-19.7	-0.13
phd	--------EEEEEE--------EEEEEE--------HHHHHHHHHHHHHH-----HHHHHHH	-22.9	-21.0	-0.14
phdpsi	--------EEEEEE-------EEEEEEE-------------EEE----HHHHHHHHHHHHHH	-15.8	-13.2	-0.11
prof_king	-------EEEEEEE-------EEEEEEE-----------EEEEEEE----EE-EEE--HHHH	-11.4	-2.1	-0.09
pssp	----EEEEEEEEEEE--------EEE-HH-----------HHHHHHH---HH-HHHHHHHHH	-16.1	-12.8	-0.03
samt99_sec	-------EEEEEE--------EEEEEE---------H-----------------H---	-13.7	-16.7	-0.03
sspro1	------EEEEEEE--------EEEEEE--------------EE-----------HHHHHHHH	-14.6	-17.1	-0.04

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)