EVA results for 1ews:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3..
seq	MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK
dssp	---EEE------EEEEE--------EEEEE--
apssp	--------------------------------	-6.5	-36.5	-0.2
phd	--EE-E-----EE--------E---EEEEE--	+3.6	+1.6	-0.07
phdpsi	--EE-E-----EE--------E---EEEEE--	+1.0	+0.1	-0.11
prof_king	-----------EEEEE--------EEEEEE--	+6.8	+9.3	-0.03
profsec	---EEEE-----------EE----EEEEEE--	-4.4	-12.5	-0.22
psipred	-----------HHH-----------EEEEE--	-4.2	-8.8	-0.08
pssp	----EEEE----EEEE--------EEEEEE--	+21.4	+38.8	+0.19
samt99_sec	-----------EEEE----------EEEE---	+2.2	+5.2	-0.07
sspro2	-----------EEEE----------EEEE---	+1.5	+6.1	-0.08

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)