EVA results for 1ev0:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,...
seq	RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK
dssp	-HHH----HHHHHHHHHHHHHHH----HHHEEEEEEEE---EEEEEEEEEE-------
jpred	---------HHHHHHHHHHHHHHEE-----EEEEE-------EEEEE-----------	-3.5	+3.9	+0.09
phd	---------HHHHHHHHHHHHHHHEEEEEEEEEEEEE----EEEEEE----HHHH---	-5.8	+2.1	+0.01
phdpsi	---------HHHHHHHHHHHHHHHH----EEEEEEE------EEEEEEE---------	+1.9	+13.3	+0.15
prof_king	---------HHHHHHHHHHHHHHEEE---EEEEEEE------EEEEEE----------	-1.9	+8.7	+0.07
profsec	---------HHHHHHHHHHHHHHHEE----EEEEEEE-----EEEEEEEE--------	+1.2	+7.6	+0.13
psipred	-------HHHHHHHHHHHHHHHHH---HHHEEEEEEE----EEEEEEEEE--------	+11.7	+19.1	+0.30
pssp	----------HHHHHHHHHHEEEEE-----EEE-EEHH----EEEE----HHHHHHH-	-11.2	-1.6	-0.08
samt99_sec	---------HHHHHHHHHHHHHHH------EEEEE-------EEEEEEE---------	0.0	+9.3	+0.15
sspro1	--------HHHHHH-HEEEEEEEEEE---EEEEEEEE----EEEEEEEE---HHHH--	-17.3	-20.3	-0.15

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)