EVA results for 1emx:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3
seq	DDCGKLFSGCDTNADCCEGYVCRLWCKLDW
dssp	-------------------E-------E--
phd	--------------------EEEEEEE---	-1.3	+3.0	-0.19
phdpsi	--------------------EEEEEEE---	-3.9	+1.5	-0.23
prof_king	-------------------EEEEEEEEE--	+2.3	+1.6	-0.08
profsec	-------------HHHH----EEEEEEE--	-13.0	-18.8	-0.30
psipred	--HHHHHH-----HHHHH--EEEEEEE---	-42.8	-51.2	-0.19
pssp	----EEEE-------EEE-EEEEEEEE---	-12.9	-29.2	-4.49
samt99_sec	-------------------EEEEEEE----	+0.8	+2.9	-0.29
sspro1	----H--------------EEEEEEEEE--	-2.6	-14.7	-0.11

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)