EVA results for 1ekt:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5...
seq	MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT
dssp	-----EEE-----------HHHHHHH-------EEEEEE--EEEEEE------
jpred	----EEEEEE----EEEE-HHHHHHH-------EEEEE---EEEEE-------	+8.8	+6.2	+0.25
phd	-----EEEE----------HHHHHHHHH-----EEEE----EEEEE-------	+17.3	+32.1	+0.37
phdpsi	-----EEEE------E---HHHHHHHHH-----EEEE---HHHHHHHH-----	-0.3	+6.5	+0.09
prof_king	---EEEEEEEE---EEEE-HHHHHH-------EEEEEE---EEEEEE------	+3.0	+0.4	+0.16
profsec	-----EEEE------EE--HHHHHH--------EEEEE----EEHHHH-----	+4.7	+6.6	+0.08
psipred	-------HHHHHH--EEE-HHHHHHH-------EEEEE---EEEEEE------	+1.2	-4.4	+0.04
pssp	---EEEEEEE----EEEEE-EEHHHHHHHHHHHHHHH--HHHHH-HH------	-25.2	-18.7	-0.11
samt99_sec	-----EEEEE----EEEE-HHHHHHH------EEEEEE---EEEEE-------	+7.1	+5.0	+0.25
sspro1	----EEEEEE----EEE--HHHHHHH------EEEEEE---EEEEEE------	+8.9	+7.7	+0.27

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)