EVA results for 1ehk:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3...
seq	EEKPKGALAVILVLTLTILVFWLGVYAVFFARG
dssp	----HHHHHHHHHHHHHHHHHHHHHHHHHHH--
phd	------EEEEEEEHHHHHHHHHHHHHHHHHH--	+1.3	+33.0	+0.27
phdpsi	-------EEHHHHHHHHHHHHHHHHHHHHHH--	+10.8	+29.8	+0.21
profsec	--------HHHHHHHHHHHHHHHHHHEEEEE--	-3.6	+24.7	+0.07
psipred	------HHHHHHHHHHHHHHHHHHHHHHHH---	+14.7	+28.3	+0.21
pssp	E-----EEEEEHHEEEEEEEEEEEEEEEEE---	-41.7	-32.0	+0.15
samt99_sec	-------HHEEEHHHHHHHHHHHHHHEEEE---	-9.1	-21.5	+0.08
sspro1	----HHHHHHHHHHHHHHHHHHHHHEEEEE---	+5.8	+29.6	+0.27

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)