EVA results for 1e9k:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,...
seq	VPEVDNPHCPNPWLNEDLVKSLRENLLQHEKSKTARKS
dssp	-----------HHHHHHH----------HHHHHHH---
apssp	----------------HHHHHHHHHHHHHHH-------	-17.3	-17.0	-0.23
jpred	---------------HHHHHHHHHHHHHHH--------	-23.9	-26.4	-0.32
phd	----------------HHHHHHHHHHHHH---------	-26.1	-28.3	-0.22
phdpsi	---------------HHHHHHHHHHHHHHH--------	-23.7	-26.6	-0.29
prof_king	---------------HHHHHHHHHHHHHH---------	-26.8	-28.7	-0.31
profsec	---------------HHHHHHHHHHHHHHHHH------	-20.9	-26.4	-0.35
psipred	---------------HHHHHHHHHHHHHHHH-------	-23.5	-27.5	+4.58
samt99_sec	---------------HHHHHHHHHHHHHHHH-------	-23.0	-26.4	+4.61
sspro2	---------------HHHHHHHHHHHHHHHH-------	-23.5	-26.2	+4.56

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)