EVA results for 1e8p:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,.
seq	ASCWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ
dssp	---HHHH---EE---HHH--EEEEE--EEEEEE--EEEEE------
apssp	------------------EEEEEE------EEE----EE-------	-6.1	-11.0	-0.05
jpred	------------------EEEEEE------EE--------------	-19.7	-36.8	-0.22
phd	---EE-----EE-------EEEEE-----EEEE----EEEEE-E--	-6.1	-7.7	-0.09
phdpsi	--EEE----EEE------EEEEEE-------EE----EEE------	-13.0	-7.0	-0.18
prof_king	-HHHHHH-----------EEEEEE----------------------	-19.8	-37.3	-0.14
profsec	--EEE----EEE-------EEEEEE----EEEE---EEEE------	-4.7	+2.6	-0.06
psipred	--HHHHHH-----------EEEEE----------------------	-19.6	-34.4	-0.16
pssp	-EEE------EEE------EEEEE----------EEEEEEEE----	-8.7	-7.1	-0.09
samt99_sec	---HHHHH-----------EEEEE-----EEE----EEEE------	-2.1	-1.6	+0.02
sspro2	1.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.001.00	+2.4	+2.8	+0.09

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)