EVA results for 1e5r:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3
seq	MRSHILGKIELDQTRLAPDLAYLAAVPTVE
dssp	---EEEEE----HHHHHHHHHHHHH-----
apssp	-------------------HH---------	-20.7	-30.8	-0.09
jpred	------------HHHH---HHHHH----HH	-10.8	-22.2	-0.07
phd	------EEEE-------HHHHHHH----HH	-14.3	+2.3	-0.06
phdpsi	------EEE---HHHHHHHHHHHH----EE	+2.7	+16.4	+0.25
prof_king	----E--EEE-------HHHHHHH----HH	-17.7	-8.1	-0.13
profsec	------EEE---HHHHHH-HHHHH----HH	-3.0	-5.8	0.00
psipred	---EEEEEEEE-HHH---HHHHHH----HH	-6.2	-12.8	+0.04
pssp	----EEE----HHH-HHH-HH-HHH----H	+13.8	-14.2	+0.25
samt99_sec	----EEEEHHH-HHHHHHHHHHHHH---HHHHH---EEEEEE--	-0.8	-2.2	+0.23
sspro2	---HEEEEEEE-HH--HHHHHHHH----HH	-7.0	-8.3	-0.02

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)