EVA results for 1e0g:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,...
seq	DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVK
dssp	---EEEE-----HHHHHHHH---HHHHHHH---HHH----EEEE----
jpred	---EEEEE----HHHHHHHHHHHHHHHHHH------------------	+2.5	-17.7	+0.07
phd	---EEEEE----HHHHHHHH---HHHHHHH------EEE--EEEEEE-	+5.2	+10.1	+0.28
phdpsi	--EEEEEE----HHHHHHH----HHHHHHE------------EEEEE-	+0.4	+5.7	+0.13
prof1	--EEEEE-----HHHHHHH----HHHHHHH-----------EEEEEE-	+4.2	+4.2	+0.18
prof_king	--EEEEEE-----EHEHH-----EEEEEE------------EEEEEE-	-18.1	-23.2	-0.13
psipred	--EEEEE-----HHHHHHHH---HHHHHHH-----------EEEEEE-	+6.6	+5.3	+0.21
pssp	--EEEEEE-----HHHHHHH--EEEEEEE-------------EEEE--	-1.1	+7.4	+0.07
samt99_sec	---EEEE-----HHHHHHHH---HHHHHHHH----------EEEE---	+11.0	+14.2	+0.25
sspro	--EEEEE----HHHHHHHHH---HHHHHHH-----------EEEEE--	+7.0	+11.5	+0.18

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)