EVA results for 1e0f:J

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,
seq	IRFGMGKVPCPDGEVGYTCDCGEKICLYGQSCNDGQCSGDPKPSSEFEEFEIDEE
dssp	-EE-----E---EE----EE----EE----EE----EE-----------------
phd	-EEE---E----------------E----------EEE--------EEEEEE---	-2.3	-20.3	-0.25
phdprof	--------E--------------EE----------EEEE-------EEEEEE---	-2.0	-13.4	-0.22
phdpsi	-EEE---E----------------E----------EEE--------EEEEEE---	-5.3	-23.1	-0.29
psipred	----------------EEE----EEEEE---------------------------	-3.7	-22.7	-0.35
pssp	----EEEEEE---EEEEE----EEEEEEE-----------------EEEE-----	-13.1	-21.1	-0.19
samt99_sec	----------------EE-----EEEEE------------------HHHEE----	-14.6	-33.0	-0.29
sspro	----------------------------------------------EEEEEE---	-10.0	-52.9	-0.27

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)