EVA results for 1e0f:I

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,..
seq	IRFGMGKVPCPDGEVGYTCDCGEKICLYGQSCNDGQCSGDPKPSSEFEEFEIDEEEK
dssp	-EE-----E---------EE----EE-----E----E--------------------
phd	-EEE---E----------------E----------EEE--------EEEEE------	+4.0	-10.5	-0.20
phdpsi	-EEE---E----------------E----------EEE--------EEEEE------	+1.4	-12.0	-0.24
prof_king	-----------------EE-----EEE------------------------------	+11.6	-3.7	-0.18
profsec	-EE--------------------EEEE--------EE----------EEEEE-----	+2.5	-18.8	-0.24
psipred	----------------EEE----EEEEE-----------------------------	+4.5	-9.2	-0.30
pssp	----EEEEEE---EEEEE----EEEEEEE------------------EEE---HH--	-8.5	-24.3	-0.15
samt99_sec	----------------EE-----EEEEE------------------HHHH-------	-3.9	-22.1	-0.29
sspro1	-----------------------------------------------EEEEE-----	-0.5	-45.6	-0.30

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)