EVA results for 1e01:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,...
seq	DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVK
dssp	--EEEEE-----HHHHHHHH---HHHHHHH----------EEEEE---
jpred	---EEEEE----HHHHHHHHHHHHHHHHHH------------------	+5	-5.7	+0.20
phd	---EEEEE----HHHHHHHH---HHHHHHH------EEE--EEEEEE-	+11.9	+12.5	+0.41
phdpsi	--EEEEEE----HHHHHHH----HHHHHHE------------EEEEE-	+11.4	+24.4	+0.29
prof_king	--EEEEEE-----EHEHH-----EEEEEE------------EEEEEE-	-7.6	-8.8	-0.00
profsec	--EEEEE-----HHHHHHH----HHHHHHH-----------EEEEEE-	+15.3	+22.0	+0.38
psipred	--EEEEE-----HHHHHHHH---HHHHHHH-----------EEEEEE-	+17.6	+22.6	+0.44
pssp	--EEEEEE-----HHHHHHH--EEEEEEE-------------EEEE--	+9.9	+26.3	+0.21
samt99_sec	---EEEE-----HHHHHHHH---HHHHHHHH----------EEEE---	+17.9	+29.4	+0.47
sspro1	--EEEEE----HHHHHHHHH---HHHHHHH-----------EEEEE--	+17.8	+29.6	+0.42

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)