EVA results for 1dqc:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7...
seq	YLAFRCGRYSPCLDDGPNVNLYSCCSFYNCHKCLARLENCPKGLHYNAYLKVCDWPSKAGCTSVNKECHLWKT
dssp	------HHH------EEE-------EEEEEE--EEEEEE-----EEE----EEE-------------------
jpred	-------------------------EEEEE-----EEE-----------------------------------	+3.8	-20.5	-0.00
phd	-EEEE----------------EEE--E------EEEE-------E---EEEEEE-------EE------E---	-9.7	-27.3	-0.21
phdpsi	-EEEE-------------E------EEEEEE-------------E----------------------EE----	-6.8	-22.5	-0.23
prof_king	---E---------------------EEEEEE--------------E---------------------------	+0.9	-17.5	-0.12
profsec	--------------------------EEEEE----EEEE-----EE--------------------EEEEE--	-1.0	-20.8	-0.18
psipred	---EE--------------------EEEEE-----HHHH-------HHHH------HH----------EEEE-	-17.2	-34.8	-0.30
pssp	-EEEE-------------EEEEEEEEE--HHHHHHHHH-----EEEEEEEEEE---------EE---EEE---	-17.7	-28.2	-0.05
sspro1	--EEE---------------------EEEE----EEEEE-----EE---------------------------	+2.1	-6.1	-0.12

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)