EVA results for 1dpu:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....
seq	ANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
dssp	-----HHHHHHHHHHHH------EEHHHHHHH-----HHHHHHHHHHHHH---EEE-----EEEE----
phd	-----HHHHHHHHHHHH--------HHHHHHHHH---HHHHHHHHHHHH---EEEE-------------	+14.1	+15.3	+0.35
phdpsi	-----HHHHHHHHHHHH--------HHHHHHHHH---HHHHHHHHHHHH---EEEE-------------	+11.5	+13.8	+0.31
prof_king	-----HHHHHHHHHHH---------HHHHHHHHH---HHHHHHHHHHHH----EEE-------------	+11.1	+14.3	+0.27
profsec	-----HHHHHHHHHHHH--------HHHHHHHHH---HHHHHHHHHHHH---EEEEE-----EE-----	+10.6	+19.9	+0.25
psipred	-----HHHHHHHHHHHH--------HHHHHHHH----HHHHHHHHHHHHH---EE--------------	+12.2	+12.7	+0.39
pssp	----EEHHHHHHHHHH----------HHHHHHHH-----HHHHHHHHH----EEEEEE-----------	+9.5	+20.7	+0.16
sspro1	-----HHHHHHHHHHHH--------HHHHHHHHHH--HHHHHHHHHHH-----EEEE-------E----	+8.1	+16.8	+0.18

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)