EVA results for 1dmg:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	AQVDLLNVKGEKVGTLEISDFVFNIDPNYDVMWRYVDMQLSD
dssp	-EEEEE-----EEEEEE--HHHH-----HHHHHHHHHHHH--
jpred	--------------EEE------------HHHHHHHHHH---	-7.5	-11.6	+0.08
phd	--EEEEE-------EEEEE-------HHHHHHHHHHHHHHHH	-7.0	-0.8	+0.05
phdpsi	--EEEEE-------EEEEE-------HHHHHHHHHHHHHHHH	-9.6	-2.3	+0.01
prof_king	--EEEE--------EEEEEEEEEEE------EEEEE------	-31.4	-29.5	-0.26
psipred	--EEEE-----EEEEEE------------EEE----------	-16.6	-22.8	+0.09
pssp	--EEEEEEEE-HHEEEEEEEEEE------EEEEE---HH-HH	-22.4	-18.4	-0.11
sspro1	---EEEEE---E--EEEE--EEE-------EEEEEHH--H--	-23.5	-27.8	-0.19

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)