EVA results for 1dkc:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,..
seq	AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKN
dssp	-------EEE------------EEEEE----EEEEE-
jpred	------------------------EEE----------	-1.2	-18.9	-0.09
phd	-----------------EEE----EEE----EEEE--	+4.3	-9.5	-0.09
phdpsi	-----------------EEE----EEE----EEEE--	+1.7	-11.0	-0.13
prof_king	-------------------------------------	-9.4	-46.3	-0.33
profsec	--------EE-------EE----EEEE----EEEE--	+10.1	+7.5	+0.04
psipred	-----------------EE---HHH------------	-16.6	-36.3	-0.16
pssp	-EEE-------------EEEEEEEEEEEE---EEE--	-3.4	-7.4	-0.14
samt99_sec	-----------------------EEE-------E---	-0.1	-13.2	-0.05
sspro1	-----------------------EEE-------E---	-0.2	-13.0	-0.07

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)