EVA results for 1df8:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....10...,....11...,...
seq	GITGTWYNQLGSTFIVTAGADGALTGTYEAAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV
dssp	---EEEEE----EEEEEE----EEEEEEE--------EEEEEEEE----------EEEEEEEEEE----EEEEEEEEEEEEE-----EEEEEEEEEE---HHHHHH-EEEEEEEEEE-
jpred	----EEE-----EEEEEE--------EEEEEE------EEE----------------EEEEEEEE---------EEEEEEEEE-----EEEEEEEE-----------EEE--------	-6.2	+5.6	-0.11
phd	---EEEEE---EEEEEEEEE--EEEEEEEEEEE----EEEE---------------EEEEEEEEEE--------EEEEEEEEE-EEEEEEEEEHHH---------EEEEEEEEEEEE-	-0.3	+10.5	-0.08
psipred	---EEEE-----EEEEEE-----EEEEEEEEE------EEEE--------------EEEEEEEEE-------EEEEEEEEEE--EEEEEEEEEEEHH----HHHHHHHHH--------	-3.5	+8.8	-0.11
sspro	----EEE-----EEEEEE-----EEEEEEEE-------EEEE----------------EEEEEE---------EEEEE-EEE---EEEEEEEEEEE---------H------------	-7.8	-3.8	-0.13

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)