EVA results for 1cix:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....
seq	YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
dssp	--------EEE----------------EEEE-------EEEE--
apssp	----------EEEE-------------E-E--------------	+1.8	+3.9	+0.03
apssp2	----EE-----EHHH------------EEE--------------	-6.4	-4.2	-0.28
jpred	----------EEEE------------------------------	-2.3	-19.1	-0.33
phd	----------EEE---------EE---EE-E-------------	+5.1	-9.7	-0.21
phdpsi	--EEEE----------------EE----EEE-------------	-4.3	-19.1	-0.31
prof_king	--------------------------------------------	+1.7	-40.8	-0.32
profsec	--EEE-----EEE---------------EEEE---------EE-	-4.7	-0.7	-0.31
psipred	----EE----HHHHH-----------------------------	-14.3	-31.3	-0.34
samt99_sec	--HHHHHH--EEEE------------------------------	-17.9	-31.2	-0.27
sspro2	----------EEEE--------------E---------------	-1.6	+1.2	-0.33

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)