EVA results for 1by6:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	AVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
dssp	--------------------------HHH--HHH--
jpred	---HHHHHH------EEHHH--HHHHHHHHHH----	-27	-46.9	-0.30
phd	-----HHHHH---HHHHHHHHHHHHHHHHHHH----	-32.4	-45.3	-8.02
phdpsi	-----HHHHH---HHHHHHHHHHHHHHHHHHH----	-35.0	-46.8	-8.06
prof_king	--HHHHHHHH-----EEEEE----HHHHHHHH----	-27.1	-46.7	-0.27
profsec	---HHHHHHH---HHHHHHHHHHHHHHHHHHH----	-43.0	-55.4	-0.34
psipred	---HHHHHHHH------HHHHHHHHHHHHHHH----	-34.4	-46.4	-0.36
pssp	--HHHHHHHHHHHHHHH-EEEEEE-HHHHHH-----	-37.9	-48.0	-0.08
samt99_sec	---HHHHHHHHH-HHHHHHHHHHHHHHHHHHHH---	-45.2	-57.6	-0.32
sspro1	---HHHHHHH----HHHHHHHHHHHHHHHHHH----	-39.8	-50.2	-0.35

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)