EVA results for 1oc0:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,..
seq	ESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAEC
dssp	-----------------E----HHHH--E---HHHH-
jufo	-------------------HHHHHHH---HHHHHH--	+5.7	+3.9	-0.00
phd	----------------EE-------------HHHHHH	+7.3	-0.7	-0.06
phdpsi	----------------EE-------------HHHHHH	+5.6	-2.2	-0.08
prof_king	------E-------------HHHHHH-H-HHHHHHH-	+2.7	-7.5	+0.06
profsec	----------------EE-------------------	-1.9	-18.2	-0.17
prospect	------EE---------------------HHHHHHHH	-4.1	-24.8	-0.2
samt99_sec	--------------------------------HHHHH	+6.3	-19.4	-0.08
scratch	HH-----------------HHHHHHHHH----HHHH-	+1.1	+5.6	+0.02

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)