EVA results for 1k0p:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3.
seq	ICEEPTCRNRTRHLPLQFSRTGPLCPACMKA
dssp	---HHHHHHHHH-------------------
jufo	-------------------------------	+1.0	-10.1	-0.27
phd	-------------------------------	-0.0	-10.2	-0.29
phdpsi	-------------------------------	-1.7	-11.7	-0.31
prof_king	-------------------------------	-1.9	-12.2	-0.31
profsec	-------------------------HHH---	-13.6	-35.7	-0.26
prospect	-------------------------------	-0.7	-11.5	-0.31
samt99_sec	-------------------------------	-3.7	-13.1	-0.34
scratch	----------------EE--------H----	-13.2	-35.9	-0.26

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)