EVA results for 1h5o:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
dssp	-HHHHHH-EEEEE----------E---------EEEEE----
jufo	---------------EEEE-------------HHHH------	-22.6	-32.9	-0.13
phd	----------------E-------------------E-----	-11.3	-30.9	-0.26
phdpsi	----------------E-------------------E-----	-13.3	-32.7	-0.28
prof_king	----------------EEE--------------EEE------	-13.6	-24.4	-0.25
profsec	----------------EE--------------EEEEEE----	-10.6	-25.3	-0.21
prospect	-------------------------------EEEEEE-----	-7.3	-29.3	-0.18
samt99_sec	---------------EEE-------------EEEE-------	-22.2	-30.4	-0.30
scratch	--------------EEEE--------------HHHE------	-25.3	-35.5	-0.28

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)