EVA results for 1m1e:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....
seq	KSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQIDQGAEDV
dssp	--HHHHHHHHHHHHHHHHHH------HHHHHHHHH-HHHHHHHH----------
apssp	----HHHHHHHHHHHHHHHH--------HHHHHHHH--EE------------EE	+3.4	+12.8	+0.03
apssp2	--HHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHH-----E	+10.5	+13.7	+0.06
prof_king	--HHHHHHHHHHHHHHHHHHH-------HHHHHHHH-HHHHHHHHHH------E	+8.8	+20.7	+0.03
samt99_sec	--HHHHHHHHHHHHHHHHHHH-------HHHHHHHHH--HHHHHHHHHH----EEEEEE---H--	-6.0	-23.5	-0.04
sspro2	--HHHHHHHHHHHHHHHHHHH-------HHHHHHHHH-HHH-HHHHH-----HE	+2.1	+0.8	-0.02

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)