EVA results for 1msz:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6..
seq	GVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRA
dssp	--HHHHHHHHHHHHH---EEEE------HHHHHHHHHHHH--EEEEEE------EEEEEE--
apssp	--HHHHHHHHHHHHHHHHH-----------HHHHHHHHHHH------------EEEEE----	+1.1	+5.8	+0.14
apssp2	--HHHHHHHHHHHHHHHH--E--------HHHHHHHHHHHH------------EEEEEE---	-0.8	+3.1	+0.13
jpred	--HHHHHHHHHHHH------EE--------HHHHHHHHHHH-----------EEEEEE----	+0.5	+6.9	+0.12
prof_king	--HHHHHHHHHHH------EEE--------HHHHHHHHHH------------EEEEEEEE--	+4.6	+10.2	+0.20
prospect	---HHHHHHHHHH-----EE--------HHHHHHHHHHHHH-----------EEEEEEE---	+4.3	+13.5	+0.16
psipred	-HHHHHHHHHHHHH----EEE------HHHHHHHHHHHHHH-----------EEEEEEEE--	+1.2	+6.1	+0.11
samt99_sec	-HHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHH------------EEEEE----	-6.5	-2.7	0.00
sspro2	--HHHHHHHHHHHH----H---------H-HHHHHHHHHHH-----------EEEEEEE---	-0.8	-4.4	+0.09

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)