EVA results for 1kwi:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6.
seq	ALSYREAVLRAVDRLNEQSSEANLYRLLELDGTPKPVSFTVKETVCPRPTRQPPELCDFKE
dssp	-HHHHHHHHHHHHHHHHH----EEEEEEEE----EEEEEEEEEEEEE------HHH--E--
apssp	-HHHHHHHHHHHHHHH----HHHHHEEEE-------E-EEEEEEE----------------	+3.8	-1.6	+0.13
apssp2	---HHHHHHHHHHHHHH------HHHE---------EEEEEEEE-----------------	-6.1	-4.0	+0.02
jpred	---HHHHHHHHHHHH------HHHHHHH--------EEEEEEEEE----------------	-9.7	-4.8	-0.05
prof_king	---HHHHHHHHHHHH--------EEEEEE-------EEEEEEEEE----------------	+1.0	+8.8	+0.19
prospect	---HHHHHHHHHHHH-------HHHHHH--------EEEEEEEE-----------------	-7.5	-2.0	0.00
psipred	---HHHHHHHHHHHHHH-----HHHHHH--------EEEEEEE----------HHH-----	-7.2	-1.4	+0.01
samt99_sec	-HHHHHHHHHHHHHHHH------HHHEE---	+1.5	+10.1	+0.11
sspro2	---HHHHHHHHHHHHH-------HHHHH--------EEEEEEEE-----------------	-9.4	-5.0	-0.01

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)