EVA results for 1l2w:I

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,..
seq	SVGEMSGRSVSQQTSDQYANNLAGRTESPQGSSLASRIIERLSSVAHSVIGFIQRMF
dssp	---EE--EEEEEE---HHHHHHH---------------EEE-----HHHHHHHHHH-
apssp	---------------HHHHH-------------HHHHHHHHHHHHHHHHHHHHH---	-23.8	-25.4	-0.33
apssp2	----------HHHH-HHHHHH-----------HHHHHHHHHHHHHHHHHHHHHHHH-	-28.7	-27.2	-0.42
phd	--------------HHHHHHHHHH--------HHHHHHHHH--HHHHHHHHHHHH--	-12.6	-6.7	-0.07
phdpsi	---E----------HHHHHHH-----------HHHHHHHHHHHHHHHHHHHHHHH--	-19.8	-17.2	-0.20
prof_king	---------------HHHHHH------------HHHHHHHHHHHHHHHHHHHHHHH-	-16.7	-17.0	-0.17
profsec	-EEEE---E-----HHHHHHHH----------HHHHHHHHHHHHHHHHHHHHHHHH-	-18.6	-13.6	-0.18
psipred	----------HHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHHHHHHH-	-23.5	-27.2	-0.27
sspro2	--------E-----HHHHHHH-----------HHHHHHHHHHHHHHHHHHHHHHHH-	-20.8	-19.6	-0.22

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)