EVA results for 1k8v:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....
seq	PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF
dssp	------------------HHHHHHHHHHHHHHHHH----
apssp	-----E------EHH-HHHHHHHHHHHHHHHHHH-----	+5.6	-20.9	+0.03
apssp2	-----E--HHHHEE--HHHHHHHHHHHHHHHHHH-----	-8.7	-33.5	-0.19
phd	----EEE--------HHHHHHHHHHHHHHHHHHH-----	+11.5	+1.7	+0.21
phdpsi	----EEE---------HHHHHHHHHHHHHHHHHH-----	+10.3	+0.3	+0.21
profsec	----EEE---------HHHHHHHHHHHHHHHHHH-----	+8.0	-2.6	+0.17
psipred	--------HHHHEE--HHHHHHHHHHHHHHHHHH-----	-1.0	-11.4	-0.06
samt99_sec	-----EE---------HHHHHHHHHHHHHHHHHH-----	+11.7	+1.3	+0.19
sspro2	----EEE------E--HHHHHHHHHHHHHHHHHH-----	+5.1	-20.1	+0.15

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)