EVA results for 1jni:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6..
seq	QPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVPRRYFCLQCHVS
dssp	-------------EE--EE--HHHH----HHHH------HHH-------------HHH----
apssp	------------EEE-----EEE-------------EE--EEE-----------EEEE----	-12.0	-13.6	-0.29
apssp2	------------EE------------HH-HHH---------EEE--------EEEEE--E--	-20.5	-17.1	-0.48
jpred	-------------E-------E------------------EE-----------EEEEE----	-4.5	-9.4	-0.16
phd	------------EE----------------------EEEEEEE---------EEEEEEEEE-	-15.8	-15.9	-0.25
phdpsi	------------EE-------E--------------EEEEEEEE--------EEEEEEEEE-	-21.0	-16.9	-0.30
prof_king	------------EEEE----EEEE------------EEEEEEE---------EEEEEEE---	-18.1	-9.9	-0.25
profsec	-----------EEEE-----EEEE------------EE---EEEE-------EEEEEEEEE-	-24.9	-23.9	-0.35
psipred	------------EEE-------------HHH-----------EE--------EEEEE-----	-11.8	-9.0	-0.34
sspro2	------------EEE------HH---HHHHHH----------EE--------EEEEE-E---	-10.8	+1.3	-0.28

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)