EVA results for 1le8:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5...
seq	KSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
dssp	-----HHHHHHHHHHHHH-----HHHHHHHHHH----HHHHHHHHHHHHH---
apssp	---HHHHHHHHHHHHHHH-----HHHHHHHHHHH-----EEEEEEE-HHHHH-	-4.9	+4.7	-0.09
apssp2	-----HHHHHHHHHHHH------HH---HHHH-------EEEEEEE-------	-17.5	-20.3	-0.18
jpred	-----HHHHHHHHHHHHHH----HHHHHHHHHHH----HHHHHHHHHHH----	+18.5	+30.7	+0.24
phd	-----HHHHHHHHHHHHH-----HHHHHHHHHHH----HHHHHHHHH------	+19.9	+31.4	+0.27
phdpsi	-----HHHHHHHHHHHH------HHHHHHHHHH----HHHHHHHHHHH-----	+20.0	+28.9	+0.39
prof_king	-----HHHHHHHHHHHHHH----HHHHHHHHHH----EEEEEEEEE-------	-1.0	+2.5	+0.12
profsec	-----HHHHHHHHHHHHH-----HHHHHHHHHH----HHHHHHHHHH------	+17.7	+25.1	+0.35
psipred	-----HHHHHHHHHHHHH-----HHHHHHHHHHH---HHEEEHEE--------	+1.2	-10.3	+0.02
sspro2	-----HHHHHHHHHHHHH-----HHHHHHHHHHH----HHEHEHHHHHHH---	+15.5	-3.7	+0.29

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)