EVA results for 1gc0:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4.
seq	LPGFATRAIHHGYDPQDHGGALVPPVYQTATFTFPSNPTLN
dssp	---HHHHHHH----HHHH--E----E-----E-----HHHH
apssp	--------E---------------------EE-------HH	-15.6	-37.9	-0.27
apssp2	---HHHHHH-----------------E--EEEE------HH	-15.2	-21.5	-0.21
jpred	--------------------------------------HHH	-10.6	-50.7	-0.14
phd	-----EEEEE---------------EEEEEEEE------HH	-19.4	-33.6	-0.17
phdpsi	------EE-----------------EEEEEEE-------HH	-20.5	-37.1	-0.21
prof_king	-----EEEEE--------------EEEEEEEEE------HH	-25.8	-37.8	-0.25
profsec	-----EEEEE-----------EE--EEEEEEEE------HH	-30.3	-34.7	-0.29
psipred	---HHHHHHH-------------------EEEEE----HHH	-4.7	-20.1	-0.01
sspro2	-----EHEEE---------------EEEE-E--------HH	-20.8	-34.0	-0.26

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)