EVA results for 1l0y:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6...
seq	AVTQSPRNKVAVTGGKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYK
dssp	-EEEE--EEEEE----EEEEEEE-----EEEEEEE-----EEEEEEE------EE-------E
apssp	-------E---E-------EEEE-------EEEEE----------EEEE-------------E	-8.6	-11.2	-0.23
apssp2	-EEEE--EEE-E----EEEEEEE-----EEEEEEE------EEEEEEE-----EE-------E	+11.5	+12.4	+0.17
jpred	--------EEE-----EEEEEEE------EEEEE-------EEEEEE----------------	+6.6	+5.9	+0.09
phd	---------------EEEEEEEE------EEEEEE------EEEEEE---------------E	+7.8	+0.4	+0.06
phdpsi	----------------EEEEEEE----EEEEEEEE-----EEEEEEEEE-------------E	+3.2	-3.3	-0.06
prof_king	--EE---EEEEE---EEEEEEEE-----EEEEEEE-----EEEEEEEE------------EEE	+12.3	+14.5	+0.11
profsec	--------EEE----EEEEEEEE----EEEEEEEE-----EEEEEEEE-------------EE	+4.2	+3.7	-0.06
psipred	--EE---EEEEE----EEEEEEE-----EEEEEEE------EEEEEE-----EE-------EE	+13.0	+21.6	+0.15
sspro2	---------------EEEEEEE------EEEEEEE------EEEEEEE---------------	-2.8	-8.8	-0.14

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)