EVA results for 1l1c:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,
seq	MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDV
dssp	--EEEEEE--EEEEE-----EEEEE---------------HHH--EEEEEE----
apssp	-HHHHHH---EEEEEE----EEEEE---------------HH--EEEEEE-----	+5.2	+16.4	+0.08
apssp2	-EEEEEE---EEEE------EEEEEE--------------HHH--EEEEE-----	+16.5	+30.3	+0.29
jpred	---HHHH---EEEEE-----EEEEE-------------------EEEEEE-----	+5.5	+10.6	+0.14
phd	--EEEEE---EEEEE-----EEEEE---EEEE-----------EEEEEEEE----	+12.1	+5.4	+0.19
phdpsi	-EEEEE----EEEEE----EEEEEEE---EEEE----------EEEEEEEEE---	-1.8	-3.6	-0.04
profsec	-EEEEE----EEEEE-----EEEEEE-EEEEE-----------EEEEEEEEE---	-4.0	-9.4	-0.08
psipred	-EEEEEE---EEEEE-----EEEEEE--------------HHH--EEEEE-----	+15.4	+24.2	+0.30
samt99_sec	-EEEEEE---EEEEE-----EEEEE---------------HHHHHEEEEE-----	+15.1	+22.5	+0.30
sspro2	--EEEEE---EEEEE-----EEEEEE-EEEEE--------HHHHEEEEEE-----	+4.3	-0.2	+0.07

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)