EVA results for 1kvk:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7...
seq	MLSEVLLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLVLRPQSNGKVSLNLPNVGIKQVWDVATLQLLDTE
dssp	-----EEEEEEEEEEEE---HHHH---EEEEEEEEEEEEEEEE----EEEEEE----EEEEEEHHHHH-----
apssp	--HHHHEE-----EEEEE-EEEE----EEEEEE--EEEEEEE-----EEEEEE--------E--HHHHH---H	-10.3	-12.6	-0.14
apssp2	-----EEEE---EEEEE---EEE---EEEEEE----EEEEEE-----EEEEE-------------------H-	-9.9	-17.6	-0.14
jpred	----EEEE-----EEEEE--EEE----HHHHHH--EEEEEEE-----EEEEE-------------------HH	-21	-18.4	-0.22
phd	------EE----EEEEEE-EEEEEHHHHHHHHHHHHEEEEEEE----EEEEEE------------------HH	-18.9	-19.9	-0.12
phdpsi	----EEEE----EEEEEE-EEEE----EEEEEEEEEEEEEEEE----EEEEEE--------------------	-4.6	-11.4	-0.10
profsec	----EEEEE---EEEEEEEEEEE----EEEEEEE-EEEEEEEE----EEEEEE------------------H-	-9.6	-20.3	-0.17
psipred	-----EEEE--EEEEE----EEE---EEEEEE----EEEEEEE----EEEEEE------------------H-	-10.1	-22.6	-0.15
sspro2	----EEEE----EEEEEE-EEEE----EEEEEEEEEEEEEEE-----EEEEE-----------HHH-----HH	-8.9	-6.3	-0.16

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)