EVA results for 1kjk:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....
seq	DLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGH
dssp	-----EEE-----EEEE------EEEEE--HHHHHHHHHHHHHHHHH--
apssp	-----EEEE----EEE--------------HHHHHHHHHHHHHHHH---	+8.9	+12.5	+0.27
apssp2	------EEE---EEEEE------------HHHHHHHHHHHHHHHHH---	+5.2	+11.8	+0.17
jpred	------EE----EEEE--------------HHHHHHHHHHHHHHHH---	+7.1	+12.4	+0.26
phd	-----EEE-----EEE------------------EEHHHHHHHEE----	-2.3	-0.7	+0.08
phdpsi	------------EEEE--------------HHHHHHHHHHHHHHHH---	+3.0	-3.9	+0.27
profsec	------------EEEEE------------HHHHHHHHHHHHHHHHH---	+0.8	-5.5	+0.16
psipred	------EEE---EEEEE------------HHHHHHHHHHHHHHHHH---	+2.3	+5.7	+0.13
samt99_sec	------EE----EEEEE------------HHHHHHHHHHHHHHHHH---	+5.8	+12.3	+0.20
sspro2	-----EEEE---EEEEE-----------HHHHHHHHHHHHHHHHHH---	+2.1	+8.2	+0.11

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)