EVA results for 1krl:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,...
seq	GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYE
dssp	--EEEE---HHHHHHHHHHHHHHHHH-------EEEEEEEEEEEEE--
apssp	-EEEEE----HHHHHHHHHHHHHH---------EEEEEEE----EE--	+8.4	+7.2	+0.23
jpred	---EEEE----------EEE----------------EE----------	-36.9	-38.9	-0.30
phd	--EEEE------HHHHHHH----------E-E----EEE-----EEE-	-13.3	-23.9	+0.04
phdpsi	--EEEE-----------EE----------EE-----EEE-----EEE-	-32.8	-39.7	-0.22
profsec	-EEEEEE----------EEEHHH-----EEEE----EEE---EEEEE-	-32.9	-36.6	-0.23
psipred	--EEEEE---HHHHHHHH-------------EEHHHHHHHHHHH----	-29.4	-20.8	-0.11
samt99_sec	--EEEEE-----------E---HH-H-----EEEHEEE------EEE-	-27.8	-40.8	-0.19
sspro2	--EEEEE--HHHHHH------HHH------EEEE--EE------EE--	-19.2	-32.5	-0.07

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)