EVA results for 1kqs:Z

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,.
seq	TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
dssp	----HHHH-------EEE------EEEE----EE--------------HHH-----
apssp	---------------EEEEEE-----------HH-----------HHHHHHHH---	-6.9	-11.6	-0.26
jpred	---------------EEEEE------------------------------------	-1.2	-34.7	-0.22
phd	----------------EEE------EEEE----EEE----------EEEE------	+1.8	+9.6	-0.12
phdpsi	----------------EEE-------EEE----EEE--------EEEEEE------	-8.4	-1.3	-0.27
profsec	---------------EEEE-----EEEEEE--EEEE--------EEEEEEEE----	-7.1	-0.0	-0.11
psipred	------HHH------EEEEE--------------------------EEE-------	-5.9	-15.5	-0.29
sspro2	---------------EEEE-------EEEEE-E--------HHHHHH--HHHH---	-13.2	-19.6	-0.22

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)