EVA results for 1jza:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,.
seq	KEGYLVNKSTGCKYGCLKLGENEGCDKECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSCS
dssp	--EE-E------E-E----E--HHHHHHHH-------EEEE---EEEEE----------E--E---
apssp	---EEEE-----EEEEE---------HHHH-------EEEEE--EEEEE-----------------	+3.9	+0.6	+0.02
jpred	----EE------EEEEEE--------HHH-----------EE---EEE------------------	-6.2	-13.1	-0.14
phd	--EEEE------EEEEEE------HHHHHHHH------EEEEEEEEE-------------------	+3.1	-4.8	+0.04
phdpsi	---EEE-----EEEEEE-------HHHHHH---------EEE--EEEE------------------	+2.7	+1.1	+0.05
profsec	--EEEE-----EEEEEE--------HHHHH---------EEE--EEEE------------------	+0.5	-2.9	-0.00
psipred	----EEE-----EEEEEE--------HHHHH-------EEE----EEEE------EEEE-------	-10.6	-4.9	-0.19
sspro2	---EEEE-----EEEEEE--------HHHHHH-------EEEEEEEEE------------------	-10.8	-17.9	-0.20

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)